Allele Report for DRB1*11:14:02

DRB1*11:14:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*111402 Local Names: DRB1*1114var
IMGT/HLA Acc No: HLA02106 OMIM Entry: *142857
Assigned: 2005-01-31 Sequence Last Modified: 2005-04-08
Source Entries: AY877348 , AY884215  
Cells Sequence Derived From: ALX0006 , ALX0007  
Known Ethnic Origin Of Source: Black
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: DR11(5)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 3 DR11 [94-100%]
NMDP (2008) 2 DR11 [100%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEDERAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACGGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo