Allele Report for DRB1*11:13:01

DRB1*11:13:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*111301 Local Names: DRB1LG1, PAL-6117, SB 1194 14/11 , DR11-14, DRB1*1418T
IMGT/HLA Acc No: HLA00767 OMIM Entry: *142857
Assigned: 1993-12-21 Sequence Last Modified: 2006-01-12
Source Entries: AM109983 , L29081 , U03291 , U09200 , X76194 , X87677 , Z37162  
Cells Sequence Derived From: 30251 , BV0595 , EmKa , JOK , PAL-6117 , SB-(2) , TER327  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Well-Documented
Publications
Rosenberg SM et al. Tissue Antigens 45:125-8 1995. (View abstract)
Smith AG et al. Tissue Antigens 48:118-26 1996. (View abstract)
Hashemi S et al. Tissue Antigens 47:155-8 1996. (View abstract)
Anholts JD et al. Hum Immunol 42:15-22 1995. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 7 Laboratories: 6
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: DR11(5)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 2 DR11 [93%]
NMDP (2008) 7 DR11[86%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments: DR11x14 
Protein Sequence (187 aa)
GDTRPRFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDLLERRRAAVDTYCR
HNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVM
LETVPRSGEVYTCQVEHPSVTSPLTVE
Nucleotide Sequence Data (562 bps)
GGGGACACCAGACCACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCT
GGACAGATACTTCCATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGG
GGCGGCCTGATGAGGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGCGGTGGACACCTATTGCAGA
CACAACTACGGGGTTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCA
GCCCCTGCAGCACCACAACCTGCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGA
ATGGCCAGGAAGAGAAGACGGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATG
CTGGAAACAGTTCCTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGA
AT
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo