Allele Report for DRB1*11:11:01

DRB1*11:11:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*111101 Local Names: DR11.6, DR11BRA
IMGT/HLA Acc No: HLA00765 OMIM Entry: *142857
Assigned: 1993-11-08 Sequence Last Modified: 2003-07-12
Source Entries: AY174184 , AY296120 , L23990 , L26306  
Cells Sequence Derived From: 1082 , BRI-7 , S.D.DNA#15775 , TER-144  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Smith AG et al. Tissue Antigens 44:52-6 1994. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: DR11(5)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 3 DR11 [87-90%] DR13 [7-8%] DR5 [4-5%]
NMDP (2008) 10 DR11 [90%] DR5 [10%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments: DR11x13  
Protein Sequence (94 aa)
GDTRPRFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDERAAVDTYCR
HNYGVGESFTVQRR
Nucleotide Sequence Data (283 bps)
GGGGACACCCGACCACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCT
GGACAGATACTTCTATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGG
GGCGGCCTGATGAGGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGA
CACAACTACGGGGTTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo