Allele Report for DRB1*11:10:01

DRB1*11:10:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*111001 Local Names: DR11.5
IMGT/HLA Acc No: HLA00764 OMIM Entry: *142857
Assigned: 1993-11-08 Sequence Last Modified: 2004-04-05
Source Entries: AY504813 , L23986  
Cells Sequence Derived From: BRI-6 , GN0094  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Common
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 2 DR11 [100%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACGGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo