Allele Report for DRB1*11:07

DRB1*11:07 View HGVS Report
Pre-2010 Nomenclature: DRB1*1107 Local Names: RMS21
IMGT/HLA Acc No: HLA00760 OMIM Entry: *142857
Assigned: 1993-05-10 Sequence Last Modified: 2004-04-05
Source Entries: AY504812 , X73027 , X82507  
Cells Sequence Derived From: BEL6KG , GN00086 , RMS21  
Known Ethnic Origin Of Source: American Indian, Caucasoid
Publications
Middleton D et al. Tissue Antigens 42:160-3 1993. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: DR11(5)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 3 DR11 [100%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not assigned
Comments: DR11x3; NN: DR17 DR3 DR11 
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDLLEQKRGRVDNYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo