Allele Report for DRB1*11:01:07

DRB1*11:01:07 View HGVS Report
Pre-2010 Nomenclature: DRB1*110107 Local Names: DRB1*1101var
IMGT/HLA Acc No: HLA02916 OMIM Entry: *142857
Assigned: 2007-04-30 Sequence Last Modified: 2007-07-09
Source Entries: AM689932 , AM712089  
Cells Sequence Derived From: 06460211 , CGE691  
Known Ethnic Origin Of Source: Unknown
Publications
Rahal M et al. Tissue Antigens 71:238-41 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: DR11(5)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 15 DR11 [88-100%]
NMDP (2008) 3474 DR11 [92%] DR5 [5%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR11
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGAGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo