Allele Report for DRB1*11:01:05

DRB1*11:01:05 View HGVS Report
Pre-2010 Nomenclature: DRB1*110105 Local Names: DRB1*1101V1
IMGT/HLA Acc No: HLA01747 OMIM Entry: *142857
Assigned: 2003-05-22 Sequence Last Modified: 2003-07-12
Source Entries: AB106129 , AJ878425  
Cells Sequence Derived From: MHH-0107122 , TBC-33607  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: DR11(5)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 15 DR11 [88-100%]
NMDP (2008) 3474 DR11 [92%] DR5 [5%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR11
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo