Allele Report for DRB1*10:01:03

DRB1*10:01:03 View HGVS Report
Pre-2010 Nomenclature: DRB1*100103 Local Names: DRB1
IMGT/HLA Acc No: HLA03427 OMIM Entry: *142857
Assigned: 2008-07-30 Sequence Last Modified: 2008-10-10
Source Entries: FM162177  
Cells Sequence Derived From: 18794  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR10 WHO Assigned Type: DR10
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 14 DR10 [87-100%]
NMDP (2008) 894 DR10 [90%] DR1 [4%] blank [2%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR10
Comments:
Protein Sequence (183 aa)
RFLEEVKFECHFFNGTERVRLLERRVHNQEEYARYDSDVGEYRAVTELGRPDAEYWNSQKDLLERRRAAVDTYCRHNYGV
GESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVP
QSGEVYTCQVEHPSVMSPLTVEW
Nucleotide Sequence Data (552 bps)
CACGTTTCTTGGAGGAGGTTAAGTTTGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTGCTGGAAAGACGCGTC
CATAACCAAGAGGAGTACGCGCGCTACGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAGTTCAACCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGTTCTGTGAATGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGACTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCAGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGTGTGATGAGCCCTCTCACAGTGGAATGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo