Allele Report for DRB1*09:01:07

DRB1*09:01:07 View HGVS Report
Pre-2010 Nomenclature: DRB1*090107 Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA04717 OMIM Entry: *142857
Assigned: 2010-01-31 Sequence Last Modified: 2010-10-15
Source Entries: GU370889  
Cells Sequence Derived From: 17927  
Known Ethnic Origin Of Source: Oriental
Publications
Li XF et al. Tissue Antigens 82:151-152 2013. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAVTELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGAAGCAGGATAAGTTTGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTATCTGCACAGAGGCATC
TATAACCAAGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACTTCCTGGAGCGGAGGCGGGCTGAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGAGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo