Allele Report for DRB1*09:08

DRB1*09:08 View HGVS Report
Pre-2010 Nomenclature: DRB1*0908 Local Names: Novel HLA-DRB1*09 Variant allele
IMGT/HLA Acc No: HLA03488 OMIM Entry: *142857
Assigned: 2008-09-30 Sequence Last Modified: 2008-10-10
Source Entries: FJ167397  
Cells Sequence Derived From: FJ167397  
Known Ethnic Origin Of Source: Oriental
Publications
Kim YH et al. Tissue Antigens 74:264-265 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAVTELGRPSAESWNSQKDFLERRRAEVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGAAGCAGGATAAGTTTGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTATCTGCACAGAGGCATC
TATAACCAAGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTAGCGC
CGAGTCCTGGAACAGCCAGAAGGACTTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGAGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo