Allele Report for DRB1*09:03

DRB1*09:03 View HGVS Report
Pre-2010 Nomenclature: DRB1*0903 Local Names: DE196-DR9V
IMGT/HLA Acc No: HLA01849 OMIM Entry: *142857
Assigned: 2003-12-15 Sequence Last Modified: 2004-01-16
Source Entries: AY465114  
Cells Sequence Derived From: DE196  
Known Ethnic Origin Of Source: Oriental
Publications
Liu CJ et al. Tissue Antigens 64:99-101 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR9 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR9
Comments:
Protein Sequence (89 aa)
RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAVTELGRPVAESWNSQKDFLEDRRAEVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGAAGCAGGATAAGTTTGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTATCTGCACAGAGGCATC
TATAACCAAGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGCGCCGAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGAGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo