Allele Report for DRB1*09:02:01

DRB1*09:02:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*090201 Local Names: DRB1
IMGT/HLA Acc No: HLA01513 OMIM Entry: *142857
Assigned: 2001-07-31 Sequence Last Modified: 2002-04-08
Source Entries: AY043181  
Alignment of CDS Source Entries
DRB1*01:01:01
DRB1*09:02:01
Submission 1

Locus Reference
  Virtual entry for DRB1*09:02:01 
  Individual submission(s) 
Cells Sequence Derived From: J69  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.1513 (Allele OID)
Publications
Lin J et al. Eur J Immunogenet 29:335-6 2002. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR9 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR9
Comments:
Protein Sequence (89 aa)
RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLERRRAEVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGAAGCAGGATAAGTTTGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTATCTGCACAGAGGCATC
TATAACCAAGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACTTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGAGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors