Allele Report for DRB1*09:01:06

DRB1*09:01:06 View HGVS Report
Pre-2010 Nomenclature: DRB1*090106 Local Names: NT01106
IMGT/HLA Acc No: HLA03994 OMIM Entry: *142857
Assigned: 2009-07-31 Sequence Last Modified: 2009-10-19
Source Entries: GQ373169 , JN383949  
Cells Sequence Derived From: BY00894 , NT01106  
Known Ethnic Origin Of Source: American Indian, Caucasoid
Publications
Lazaro AM et al. Tissue Antigens 77:54-61 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAVTELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGAAGCAGGATAAGTTTGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTATCTGCACAGAGGCATC
TATAACCAAGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACTTCCTGGAGCGAAGGCGGGCCGAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGAGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo