Allele Report for DRB1*09:01:04

DRB1*09:01:04 View HGVS Report
Pre-2010 Nomenclature: DRB1*090104 Local Names: HLA-DRB1*0901V1
IMGT/HLA Acc No: HLA03378 OMIM Entry: *142857
Assigned: 2008-05-21 Sequence Last Modified: 2008-10-10
Source Entries: AB436795  
Cells Sequence Derived From: JMDP36K018  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR9 WHO Assigned Type: DR9
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 19 DR9 [89-100%]
NMDP (2008) 1058 DR9 [95%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR9
Comments:
Protein Sequence (89 aa)
RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAVTELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGAAGCAGGATAAGTTTGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTATCTGCACAGAGGCATC
TATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACTTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGAGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo