Allele Report for DRB1*09:01:03

DRB1*09:01:03 View HGVS Report
Pre-2010 Nomenclature: DRB1*090103 Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA02009 OMIM Entry: *142857
Assigned: 2004-09-27 Sequence Last Modified: 2005-04-08
Source Entries: AY724685  
Cells Sequence Derived From: D073  
Known Ethnic Origin Of Source: Oriental
Publications
Hu Z et al. Tissue Antigens 65:293-4 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR9 WHO Assigned Type: DR9
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 19 DR9 [89-100%]
NMDP (2008) 1058 DR9 [95%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR9
Comments:
Protein Sequence (89 aa)
RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAVTELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGAAGCAGGATAAGTTTGAGTGTCATTTCTTCAACGGGACCGAGCGGGTGCGGTATCTGCACAGAGGCATC
TATAACCAAGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACTTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGAGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo