Allele Report for DRB1*08:44

DRB1*08:44 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DR08_513_00005
IMGT/HLA Acc No: HLA06492 OMIM Entry: *142857
Assigned: 2011-01-31 Sequence Last Modified: 2011-04-08
Source Entries: GQ132053 , GU128065 , HM467575 , HM467576 , HM467580  
Cells Sequence Derived From: HG00001832 , HG00002183 , HG00002184 , HG00002185 , HG10011870  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVMELGRPDAEYWNSQKDFLEDRRALVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGATGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCCTGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACGGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo