Allele Report for DRB1*08:32

DRB1*08:32 View HGVS Report
Pre-2010 Nomenclature: DRB1*0832 Local Names: EN120
IMGT/HLA Acc No: HLA02381 OMIM Entry: *142857
Assigned: 2005-11-21 Sequence Last Modified: 2006-01-12
Source Entries: DQ014541 , GU440755  
Cells Sequence Derived From: BY00652 , EN120  
Known Ethnic Origin Of Source: Oriental
Publications
Dang CW et al. Tissue Antigens 70:527-9 2007. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: Undefined WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not assigned
Comments: NN: DR8 DR12 
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEYRAVTELGRPSAEYWNSQKDILEDRRALVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTACTGGAGAGACACTTC
CATAACCAGGAGGAGCTCCTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACAGGCGGGCCCTGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo