Allele Report for DRB1*08:15

DRB1*08:15 View HGVS Report
Pre-2010 Nomenclature: DRB1*0815 Local Names: DRB1*08Taree
IMGT/HLA Acc No: HLA00741 OMIM Entry: *142857
Assigned: 1996-07-28 Sequence Last Modified: 2007-01-12
Source Entries: AM409250 , U63802  
Cells Sequence Derived From: 161024 , TDS-023  
Known Ethnic Origin Of Source: Australian Aboriginal
Publications
Trejaut J et al. Tissue Antigens 49:529-31 1997. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR8 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR8
Comments:
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPDAEHWNSQKDILEDRRALVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
GGAGCACTGGAACAGCCAGAAGGACATCCTGGAAGACAGGCGGGCCCTGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo