Allele Report for DRB1*08:11

DRB1*08:11 View HGVS Report
Pre-2010 Nomenclature: DRB1*0811 Local Names: DR8TL, DR8New
IMGT/HLA Acc No: HLA00737 OMIM Entry: *142857
Assigned: 1994-03-22 Sequence Last Modified: 2006-01-12
Source Entries: AM109977 , L29082 , L32810  
Cells Sequence Derived From: ARA016 , ARAC25 , JR-(2)  
Known Ethnic Origin Of Source: American Indian
Publications
Smith AG et al. Tissue Antigens 48:118-26 1996. (View abstract)
Williams TM et al. Immunogenetics 40:314-314 1994. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR8 WHO Assigned Type: DR8
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 2 DR8 [89-94%]
NMDP (2008) 10 DR8 [100%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR8
Comments:
Protein Sequence (182 aa)
RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPAAEYWNSQKDFLEDRRALVDTYCRHNYGV
GESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVE
Nucleotide Sequence Data (549 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGC
CGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCCTGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACGGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGAAT
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo