Allele Report for DRB1*08:06

DRB1*08:06 View HGVS Report
Pre-2010 Nomenclature: DRB1*0806 Local Names: DRB1*0805, DR8.6
IMGT/HLA Acc No: HLA00732 OMIM Entry: *142857
Assigned: 1992-09-09 Sequence Last Modified: 2005-07-12
Source Entries: AY961076 , L78165 , M86590 , M87543 , Z32685  
Cells Sequence Derived From: ALG , BOU , C.R. , CTM-3096152 , RBL B124 , RBL B24 , SET , SUDNA00952  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Loeffler D et al. Immunogenetics 41:56-56 1994. (View abstract)
Balas A et al. Hum Immunol 67:1008-16 2006. (View abstract)
Apple RJ et al. Tissue Antigens 40:69-74 1992. (View abstract)
Benmamar D et al. Hum Immunol 36:172-8 1993. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 8 Laboratories: 5
HLA Dictionary Data
Expert Assigned Type: DR8 WHO Assigned Type: DR8
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 4 DR8 [96-100%]
NMDP (2008) 21 DR8 [95%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR8
Comments:
Protein Sequence (262 aa)
MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVT
ELGRPSAEYWNSQKDFLEDRRALVDTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRW
FRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWSARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPT
Nucleotide Sequence Data (787 bps)
ATGGTGTGTCTGAGGCTCCCTGGAGGCTCCTGCATGGCAGTTCTGACAGTGACACTGATGGTGCTGAGCTCCCCACTGGC
TTTGGCTGGGGACACCAGACCACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGC
GGTTCCTGGACAGATACTTCTATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACG
GAGCTGGGGCGGCCTAGCGCCGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCCTGGTGGACACCTA
CTGCAGACACAACTACGGGGTTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGG
TTCCGGAATGGCCAGGAAGAGAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCT
GGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCA
CAGTGGAATGGAGTGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGGGCTTTGTGCTGGGCCTGCTC
TTCCTTGGGGCCGGGCTGTTCATCTACTTCAGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo