Allele Report for DRB1*08:01:01

DRB1*08:01:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*080101 Local Names: DRB1*08011
IMGT/HLA Acc No: HLA00723 OMIM Entry: *142857
Assigned: 1989-08-01 Sequence Last Modified: 2001-04-09
Source Entries: AF121971 , AF144105 , AF278701 , AH010612 , AH010613 , AH010614 , AJ249626 , AY028514 , AY028515 , AY028516 , AY028517 , AY028518 , AY028519 , L78166 , M17386  
Cells Sequence Derived From: 1823-T , BM9 , BTB , MADURA , MTP1 134873 , MULRe , SUDNA01406 , U-STH  
Known Ethnic Origin Of Source: Caucasoid
Publications
Bell JI et al. Proc Natl Acad Sci U S A 84:6234-8 1987. (View abstract)
Eberle M et al. Hum Immunol 40(S1):77-77 1994. (View abstract)
Greville WD et al. Tissue Antigens 59:52-4 2002. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 8 Laboratories: 5
HLA Dictionary Data
Expert Assigned Type: DR8 WHO Assigned Type: DR8
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 7 DR8 [91-100%]
NMDP (2008) 1076 DR8 [95%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR8
Comments:
Protein Sequence (179 aa)
GDTRPRFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDFLEDRRALVDTYCR
HNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVM
LETVPRSGEVYTCQVEHPS
Nucleotide Sequence Data (538 bps)
GGGGACACCCGACCACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCT
GGACAGATACTTCTATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGG
GGCGGCCTAGCGCCGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCCTGGTGGACACCTACTGCAGA
CACAACTACGGGGTTGGTGAGAGCTTCACGGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCA
GCCCCTGCAGCACCACAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGA
ATGGCCAGGAAGAGAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATG
CTGGAAACAGTTCCTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo