Allele Report for DRB1*07:21

DRB1*07:21 View HGVS Report
Pre-2010 Nomenclature: Local Names: BY00766
IMGT/HLA Acc No: HLA06298 OMIM Entry: *142857
Assigned: 2010-12-22 Sequence Last Modified: 2011-01-14
Source Entries: HQ700653  
Cells Sequence Derived From: BY00766  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Lazaro AM et al. Tissue Antigens 79:50-57 2012. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQGKYKCHFFNRTERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGGGTAAGTATAAGTGTCATTTCTTCAACCGGACGGAGCGGGTGCAGTTCCTGGAAAGACTCTTC
TATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTAGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACATCCTGGAGGACAGGCGGGGCCAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo