Allele Report for DRB1*07:03

DRB1*07:03 View HGVS Report
Pre-2010 Nomenclature: DRB1*0703 Local Names: DRB1*07RMT
IMGT/HLA Acc No: HLA00721 OMIM Entry: *142857
Assigned: 1997-10-09 Sequence Last Modified: 2010-07-16
Source Entries: GU991556 , Y13785  
Cells Sequence Derived From: BY00672 , ED01436  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Hashemi-Tavoularis S et al. Tissue Antigens 51:577-81 1998. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR7 WHO Assigned Type: DR7
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR7
Comments:
Protein Sequence (89 aa)
RFLWQGKYKCHFFNGTERVQFLESLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGGGTAAGTATAAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCAGTTCCTGGAAAGTCTCTTC
TATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTAGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACATCCTGGAGGACAGGCGGGGCCAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo