Allele Report for DRB1*07:15

DRB1*07:15 View HGVS Report
Pre-2010 Nomenclature: DRB1*0715 Local Names: DRB1*07NEW
IMGT/HLA Acc No: HLA03136 OMIM Entry: *142857
Assigned: 2007-09-25 Sequence Last Modified: 2007-10-05
Source Entries: EU131777  
Cells Sequence Derived From: SCU-1533  
Known Ethnic Origin Of Source: Unknown
Publications
Balas A et al. Tissue Antigens 71:179-80 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQGKYKCHFFNGKERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGGGTAAGTATAAGTGTCATTTCTTCAACGGGAAGGAGCGGGTGCAGTTCCTGGAAAGACTCTTC
TATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTAGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACATCCTGGAGGACAGGCGGGGCCAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo