Allele Report for DRB1*07:07

DRB1*07:07 View HGVS Report
Pre-2010 Nomenclature: DRB1*0707 Local Names: AD 65697
IMGT/HLA Acc No: HLA01620 OMIM Entry: *142857
Assigned: 2002-08-30 Sequence Last Modified: 2010-01-15
Source Entries: AJ441130 , FN556019  
Cells Sequence Derived From: 41618 , AD65697  
Known Ethnic Origin Of Source: Unknown
Publications
Frison S et al. Tissue Antigens 61:259-60 2003. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR7 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR7
Comments:
Protein Sequence (89 aa)
RFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGWPVAESWNSQKDILEDRRGQVDTVCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCCTGTGGCAGGGTAAGTATAAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCAGTTCCTGGAAAGACTCTTC
TATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTAGGGTGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACATCCTGGAGGACAGGCGGGGCCAGGTGGACACCGTGTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo