Allele Report for DRB1*07:04

DRB1*07:04 View HGVS Report
Pre-2010 Nomenclature: DRB1*0704 Local Names: DRB1*07ROS
IMGT/HLA Acc No: HLA00722 OMIM Entry: *142857
Assigned: 1998-03-05 Sequence Last Modified: 2006-01-12
Source Entries: AM109974 , Y16224  
Cells Sequence Derived From: 12827878  
Known Ethnic Origin Of Source: Caucasoid
Publications
Darke C et al. Tissue Antigens 56:467-9 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 1 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR7 WHO Assigned Type: DR7
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 2 DR7 [100%]
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR7
Comments:
Protein Sequence (179 aa)
RFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDNYCRHNYGV
GESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVMSPL
Nucleotide Sequence Data (538 bps)
CACGTTTCCTGTGGCAGGGTAAGTATAAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCAGTTCCTGGAAAGACTCTTC
TATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTAGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACATCCTGGAGGACAGGCGGGGCCAGGTGGACAATTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTGAGGTGACTGTGTATCCTGCCAAGACTCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGCTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAAGTTTACACCTGCCAAGTGGAGCACCCAAGTGTGATGAGCCCTCT
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo