Allele Report for DRB1*04:96

DRB1*04:96 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DR4I_940_00237
IMGT/HLA Acc No: HLA06488 OMIM Entry: *142857
Assigned: 2011-01-31 Sequence Last Modified: 2011-04-08
Source Entries: HQ337764 , HQ644415 , JN119555 , JQ824809 , JQ824810 , JQ824833  
Cells Sequence Derived From: HG00001046 , HG00003393 , HG00005149 , HG00005150 , HG00005151 , HG10011864  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 6 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFNSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTACGTGCGCTTCAACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGAGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo