Allele Report for DRB1*04:94N

DRB1*04:94N View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA06051 OMIM Entry: *142857
Assigned: 2010-10-31 Sequence Last Modified: 2011-01-14
Source Entries: HQ329096  
Cells Sequence Derived From: 5710903021  
Known Ethnic Origin Of Source: Oriental
Publications
Zhu FM et al. Tissue Antigens 78:226-227 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (73 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAEVDNX
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGAGGTGGACAACTAATGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo