Allele Report for DRB1*04:152

DRB1*04:152 View HGVS Report
Pre-2010 Nomenclature: Local Names: BY00984
IMGT/HLA Acc No: HLA09105 OMIM Entry: *142857
Assigned: 2012-12-31 Sequence Last Modified: 2013-01-18
Source Entries: KC296449  
Alignment of CDS Source Entries
DRB1*01:01:01

Locus Reference
  Virtual entry for DRB1*04:152 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: BY00984  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.9105 (Allele OID)
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEFVRFDSDVGEYRAVTELGRPSAEYWNSQKDLLEQRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors