Allele Report for DRB1*04:88

DRB1*04:88 View HGVS Report
Pre-2010 Nomenclature: DRB1*0488 Local Names: HIS_NEW_DRB1_251_00078, HIS_NEW_DRB1_251_00079
IMGT/HLA Acc No: HLA04384 OMIM Entry: *142857
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ438916 , FJ438917 , HM594843 , HQ230560 , HQ230563 , HQ337778 , HQ850072  
Cells Sequence Derived From: HG00000404 , HG00000405 , HG00000406 , HG00002626 , HG10011895 , HN-01694-8 , HN-04356-1  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 84:497-502 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 7 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDILEQRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGAGGCGGGCCGAGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo