Allele Report for DRB1*04:78

DRB1*04:78 View HGVS Report
Pre-2010 Nomenclature: DRB1*0478 Local Names: HLA-DRB1*04
IMGT/HLA Acc No: HLA03585 OMIM Entry: *142857
Assigned: 2008-12-22 Sequence Last Modified: 2009-01-09
Source Entries: FJ547092  
Cells Sequence Derived From: SZGSQ2  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Gao SQ et al. Tissue Antigens 73:625-627 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo