Allele Report for DRB1*04:74

DRB1*04:74 View HGVS Report
Pre-2010 Nomenclature: DRB1*0474 Local Names: DRB1*04var
IMGT/HLA Acc No: HLA03296 OMIM Entry: *142857
Assigned: 2008-04-29 Sequence Last Modified: 2008-10-10
Source Entries: AM947655 , FM886832  
Cells Sequence Derived From: FFM5175 , SI772  
Known Ethnic Origin Of Source: Caucasoid
Publications
Desaules C et al. Tissue Antigens 72:500-1 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAEVDNYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGAGGTGGACAATTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo