Allele Report for DRB1*04:73

DRB1*04:73 View HGVS Report
Pre-2010 Nomenclature: DRB1*0473 Local Names: LUMC-DR35
IMGT/HLA Acc No: HLA03167 OMIM Entry: *142857
Assigned: 2007-11-30 Sequence Last Modified: 2008-01-11
Source Entries: AM904555  
Cells Sequence Derived From: LUMC-DR35  
Known Ethnic Origin Of Source: Caucasoid
Publications
Anholts JDH et al. Tissue Antigens 74:424-428 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo