Allele Report for DRB1*04:17:02

DRB1*04:17:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*041702 Local Names: BY00541
IMGT/HLA Acc No: HLA04408 OMIM Entry: *142857
Assigned: 2009-10-31 Sequence Last Modified: 2010-01-15
Source Entries: GU066752 , GU320615 , HM467573 , HM562341 , HQ230566 , HQ590530 , HQ850073 , JF309447 , JN119551 , JN242461 , JN406385 , JQ824775 , JQ824777 , JQ824792 , JQ824795 , JQ824796 , JQ824797 , JQ824798 , KF055214 , KF055215 , KF055216  
Cells Sequence Derived From: BY00541 , BY00633 , BY00634 , BY00648 , BY00649 , BY00650 , HG00001047 , HG00002177 , HG00002178 , HG00002624 , HG00002625 , HG00003394 , HG00003395 , HG00003396 , HG00005152 , HG00005153 , HG00005154 , HG00005155 , HG00005156 , HG00005157 , HG00005158 , HG10011893 , MDA0000146 , MDA0000147 , MDA0000148  
Known Ethnic Origin Of Source: American Indian, Caucasoid, Hispanic, Mixed
Publications
Lazaro AM et al. Tissue Antigens 78:195-202 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 25 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDLLEQRRAEVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGAGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo