Allele Report for DRB1*04:15

DRB1*04:15 View HGVS Report
Pre-2010 Nomenclature: DRB1*0415 Local Names: None
IMGT/HLA Acc No: HLA00701 OMIM Entry: *142857
Assigned: 1992-09-09 Sequence Last Modified: 2006-01-12
Source Entries: AM109970 , X68272  
Cells Sequence Derived From: HOU , NIC , TER308  
Known Ethnic Origin Of Source: Caucasoid
Publications
Tiercy JM et al. Tissue Antigens 41:97-101 1993. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR4 WHO Assigned Type: DR4
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 4 DR4 [84-100%] DR11 [20%]
NMDP (2008) 3 DR4 [67%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR4
Comments: DR4x11  
Protein Sequence (181 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGV
VESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSLTSPLTV
Nucleotide Sequence Data (544 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCTATCCTGAGGTGACTGTGTATCCTGCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGCTCTGTGAATGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGACTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCCTGACGAGCCCTCTCACAGT
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo