Allele Report for DRB1*04:13

DRB1*04:13 View HGVS Report
Pre-2010 Nomenclature: DRB1*0413 Local Names: DRB1*LEV
IMGT/HLA Acc No: HLA00699 OMIM Entry: *142857
Assigned: 1992-05-26 Sequence Last Modified: 2009-10-19
Source Entries: GQ373163 , M94460  
Cells Sequence Derived From: BY00474 , LEV  
Known Ethnic Origin Of Source: Caucasoid
Publications
Petersdorf EW et al. Tissue Antigens 40:267-8 1992. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR4 WHO Assigned Type: DR4
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 3 DR4 [100%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR4
Comments:
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo