Allele Report for DRB1*04:07:04

DRB1*04:07:04 View HGVS Report
Pre-2010 Nomenclature: DRB1*040704 Local Names: HIS_NEW_DRB1_251_00085, HIS_NEW_DRB1_265_00097
IMGT/HLA Acc No: HLA04658 OMIM Entry: *142857
Assigned: 2009-12-21 Sequence Last Modified: 2010-01-15
Source Entries: FJ438923 , FJ489881 , HM068536 , HQ850071 , JN119557 , JN604884 , JQ824773 , JQ824789 , JQ824794  
Cells Sequence Derived From: HG00002628 , HG00003400 , HG00003401 , HG00005159 , HG00005160 , HG00005161 , HN-18682-5 , NT01187  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 84:497-502 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 8 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGAGGTGGACACCTACTGCAGACACAACTATGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo