Allele Report for DRB1*04:03:03

DRB1*04:03:03 View HGVS Report
Pre-2010 Nomenclature: DRB1*040303 Local Names: 173171
IMGT/HLA Acc No: HLA02717 OMIM Entry: *142857
Assigned: 2006-11-29 Sequence Last Modified: 2007-01-12
Source Entries: AM409261  
Cells Sequence Derived From: 173171  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR4 WHO Assigned Type: DR4
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 9 DR4 [97-100%]
NMDP (2008) 748 DR4 [92%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR4
Comments:
Protein Sequence (89 aa)
RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGCAGGTTAAACATGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATCACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGAGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTCCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo