Allele Report for DRB1*03:01:20

DRB1*03:01:20 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DRB1_110030_00826
IMGT/HLA Acc No: HLA07872 OMIM Entry: *142857
Assigned: 2012-04-24 Sequence Last Modified: 2012-07-12
Source Entries: JN205239 , JX228057 , JX228058 , JX228061 , JX458913 , JX458919 , JX458920 , KC537771 , KJ619556  
Cells Sequence Derived From: HG00003404 , HG00007047 , HG00007048 , HG00007049 , HG00007050 , HG00007051 , HG00007052 , HG00007053 , HG00009242  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 84:497-502 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 9 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAACGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo