Allele Report for DRB1*03:47

DRB1*03:47 View HGVS Report
Pre-2010 Nomenclature: DRB1*0347 Local Names: HIS_NEW_DRB1_136_00033, HIS_NEW_DRB1_138_00035
IMGT/HLA Acc No: HLA03859 OMIM Entry: *142857
Assigned: 2009-05-31 Sequence Last Modified: 2009-10-19
Source Entries: FJ205638 , FJ205639 , GQ449667 , GQ859586 , GQ994094 , HM159356 , HM594842  
Cells Sequence Derived From: HG00001876 , HG00002197 , HG10011842 , HG10011843 , HN-17865-8 , HN-21128-5 , HN-52293-4  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 84:497-502 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 7 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRRDAEYWNSQKDLLEQKRGRVDNYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCGTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo