Allele Report for DRB1*03:44

DRB1*03:44 View HGVS Report
Pre-2010 Nomenclature: DRB1*0344 Local Names: HistoGenetics HIS_NEW_DRB1_72_00001
IMGT/HLA Acc No: HLA03842 OMIM Entry: *142857
Assigned: 2009-05-31 Sequence Last Modified: 2009-10-19
Source Entries: FJ197336 , GQ862779 , HM594845 , HM594846 , HQ337779  
Alignment of CDS Source Entries
DRB1*01:01:01
DRB1*03:44
Submission 1
Submission 2
Submission 3
Submission 4

Locus Reference
  Virtual entry for DRB1*03:44 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: 5528727076 , HG00002199 , HG00002200 , HG10011845 , HN-32510-1  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.3842 (Allele OID)
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 84:497-502 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRYLDRYFHNQEEYARFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors