Allele Report for DRB1*03:41:01

DRB1*03:41:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*0341 Local Names: BY00423
IMGT/HLA Acc No: HLA03641 OMIM Entry: *142857
Assigned: 2009-02-28 Sequence Last Modified: 2009-04-17
Source Entries: FJ688164  
Alignment of CDS Source Entries
DRB1*01:01:01
DRB1*03:41:01
Submission 1

Locus Reference
  Virtual entry for DRB1*03:41:01 
  Individual submission(s) 
Cells Sequence Derived From: BY00423  
Known Ethnic Origin Of Source: Hispanic
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.3641 (Allele OID)
Publications
Lazaro AM et al. Tissue Antigens 76:319-324 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors