Allele Report for DRB1*03:28

DRB1*03:28 View HGVS Report
Pre-2010 Nomenclature: DRB1*0328 Local Names: NT00510
IMGT/HLA Acc No: HLA01933 OMIM Entry: *142857
Assigned: 2004-05-20 Sequence Last Modified: 2004-07-08
Source Entries: AY607029  
Cells Sequence Derived From: NT00510  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR3 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR17
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTKLGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGAAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo