Allele Report for DRB1*03:21

DRB1*03:21 View HGVS Report
Pre-2010 Nomenclature: DRB1*0321 Local Names: 17839
IMGT/HLA Acc No: HLA01501 OMIM Entry: *142857
Assigned: 2001-08-29 Sequence Last Modified: 2008-04-08
Source Entries: AJ297266  
Cells Sequence Derived From: Patient#17839  
Known Ethnic Origin Of Source: Caucasoid
Publications
Gagne K et al. Tissue Antigens 60:268-70 2002. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 1 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR3 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR17
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (267 bps)
CGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTCCA
TAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGCCG
AGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGGTT
GTGGAGAGCTTCACAGTGCAGCGGCGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo