Allele Report for DRB1*03:05:01

DRB1*03:05:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*030501 Local Names: DRB1*03051, DR3New
IMGT/HLA Acc No: HLA00677 OMIM Entry: *142857
Assigned: 1994-06-10 Sequence Last Modified: 1998-12-16
Source Entries: HE858251 , L29807 , U26557  
Cells Sequence Derived From: D186855 , TTO5607 , U-HFI (#662)  
Known Ethnic Origin Of Source: Caucasoid, Oriental
CWD v2.0 Status: Well-Documented
Publications
Asu UM et al. Tissue Antigens 46:405-7 1995. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR3 WHO Assigned Type: DR3
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR17
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo