Allele Report for DRB1*03:04:01

DRB1*03:04:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*0304 Local Names: MIT-3758
IMGT/HLA Acc No: HLA00676 OMIM Entry: *142857
Assigned: 1993-11-05 Sequence Last Modified: 2006-01-12
Source Entries: AJ409216 , AM109967 , X75441  
Cells Sequence Derived From: 35919 , GRD , MIT-3758 , TER336  
Known Ethnic Origin Of Source: Caucasoid
Publications
Anholts JD et al. Hum Immunol 42:15-22 1995. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR17 WHO Assigned Type: DR17(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 3 DR17 [50%] DR3 [44-50%]
NMDP (2008) 7 DR3 [57%] DR17 [29%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR17
Comments:
Protein Sequence (182 aa)
RFLEYSTSECHFFNGTERVRYLDRYFHNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGV
VESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVE
Nucleotide Sequence Data (549 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
CATAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGAAT
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo