Allele Report for DRB1*03:03

DRB1*03:03 View HGVS Report
Pre-2010 Nomenclature: DRB1*0303 Local Names: None
IMGT/HLA Acc No: HLA00675 OMIM Entry: *142857
Assigned: 1991-11-14 Sequence Last Modified: 2004-01-16
Source Entries: AY429722 , M81743  
Alignment of CDS Source Entries
DRB1*01:01:01
DRB1*03:03
Submission 1

Locus Reference
  Virtual entry for DRB1*03:03 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: GN00265 , RBL B25  
Known Ethnic Origin Of Source: Black
CWD v2.0 Status: Well-Documented
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.675 (Allele OID)
Publications
Apple RJ et al. Tissue Antigens 40:69-74 1992. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR18 WHO Assigned Type: DR18(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 4 DR18 [50%] DR17 [50%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR18
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors