Allele Report for DRB1*03:02:01

DRB1*03:02:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*030201 Local Names: DRB1*03021
IMGT/HLA Acc No: HLA00673 OMIM Entry: *142857
Assigned: 1989-08-01 Sequence Last Modified: 1998-12-16
Source Entries: AF029266 , M27689  
Cells Sequence Derived From: 1563 , 2041 , 24A1  
Known Ethnic Origin Of Source: American Indian, Black
Publications
Hurley CK et al. Hum Immunol 25:37-50 1989. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR18 WHO Assigned Type: DR18(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 10 DR18 [62-67%] DR3 [27-35%]
NMDP (2008) 317 DR18 [66%] DR3 [24%] DR17 [3%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR3 DR18
Comments:
Protein Sequence (237 aa)
GDTRPRFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCR
HNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVM
LETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS
Nucleotide Sequence Data (714 bps)
GGGGACACCAGACCACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCT
GGAGAGATACTTCCATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGG
GGCGGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGA
CACAACTACGGGGTTGGTGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCA
GCCCCTGCAGCACCACAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGA
ATGGCCAGGAAGAGAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATG
CTGGAAACAGTTCCTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGA
ATGGAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGGGCTTTGTGCTGGGCCTGCTCTTCCTTG
GGGCCGGGCTGTTCATCTACTTCAGGAATCAGAAAGGACACTCTGGACTTCAGCCAAGAGGATTCCTGAGCTGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo