Allele Report for DRB1*03:01:04

DRB1*03:01:04 View HGVS Report
Pre-2010 Nomenclature: DRB1*030104 Local Names: VTIS 65942
IMGT/HLA Acc No: HLA02830 OMIM Entry: *142857
Assigned: 2007-02-28 Sequence Last Modified: 2007-04-12
Source Entries: DQ133168  
Cells Sequence Derived From: VTIS65942  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR17 WHO Assigned Type: DR17(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 36 DR17 [33-70%] DR3 [20-50%] DR18 [0-11%]
NMDP (2008) 9698 DR17 [64%] DR3 [33%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR3 DR17
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCAGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo