Allele Report for DRB1*03:01:02

DRB1*03:01:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*030102 Local Names: DRB1*03012, DRB1*IMR
IMGT/HLA Acc No: HLA00672 OMIM Entry: *142857
Assigned: 1992-04-22 Sequence Last Modified: 2005-04-08
Source Entries: AY961064 , L07767 , M91807  
Cells Sequence Derived From: 21 , CTM-2095057 , M.R.  
Known Ethnic Origin Of Source: Caucasoid
Publications
Eberle M et al. Tissue Antigens 40:150-2 1992. (View abstract)
Balas A et al. Hum Immunol 67:1008-16 2006. (View abstract)
Buyse I et al. Immunogenetics 38:380-380 1993. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR17 WHO Assigned Type: DR17(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 36 DR17 [33-70%] DR3 [20-50%] DR18 [0-11%]
NMDP (2008) 9698 DR17 [64%] DR3 [33%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR3 DR17
Comments:
Protein Sequence (266 aa)
MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVT
ELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRW
FRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPRGFLS
Nucleotide Sequence Data (801 bps)
ATGGTGTGTCTGAGGCTCCCTGGAGGCTCCTGCATGGCAGTTCTGACAGTGACACTGATGGTGCTGAGCTCCCCACTGGC
TTTGGCTGGGGACACCAGACCACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGC
GGTACCTGGACAGATACTTCCATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACG
GAGCTGGGGCGGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAATTA
CTGCAGACACAACTACGGGGTTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAA
AGACCCAGCCCCTGCAGCACCATAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGG
TTCCGGAATGGCCAGGAAGAGAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCT
GGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCA
CAGTGGAATGGAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGGGCTTTGTGCTGGGCCTGCTC
TTCCTTGGGGCCGGGCTGTTCATCTACTTCAGGAATCAGAAAGGACACTCTGGACTTCAGCCAAGAGGATTCCTGAGCTG
A
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo